Protein Info for Xcc-8004.3982.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Propionate catabolism operon regulatory protein PrpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 549 TIGR02329: propionate catabolism operon regulatory protein PrpR" amino acids 28 to 542 (515 residues), 852.6 bits, see alignment E=5.4e-261 PF06506: PrpR_N" amino acids 53 to 214 (162 residues), 156.5 bits, see alignment E=1.5e-49 PF00158: Sigma54_activat" amino acids 237 to 402 (166 residues), 208.1 bits, see alignment E=2.2e-65 PF14532: Sigma54_activ_2" amino acids 238 to 407 (170 residues), 63 bits, see alignment E=1.1e-20 PF07728: AAA_5" amino acids 260 to 378 (119 residues), 27.4 bits, see alignment E=9e-10 PF02954: HTH_8" amino acids 511 to 541 (31 residues), 34.9 bits, see alignment (E = 3e-12)

Best Hits

KEGG orthology group: K02688, transcriptional regulator, propionate catabolism operon regulatory protein (inferred from 100% identity to xca:xccb100_3315)

Predicted SEED Role

"Propionate catabolism operon regulatory protein PrpR" in subsystem Methylcitrate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBV5 at UniProt or InterPro

Protein Sequence (549 amino acids)

>Xcc-8004.3982.1 Propionate catabolism operon regulatory protein PrpR (Xanthomonas campestris pv. campestris strain 8004)
MKQSEHYATSLKRQRIMPHSSFVAPADGTLPVIWTVSVSRLTGLLADVIPEFDQRAHIEQ
INLGFAEAVEVIGQRLRRERCDVLVAGGSNAAYLRSRLPLPLAPIQATGFDLMEALARAR
RIAPRIGVVTHATDVPSFQPFQDSFALDIAHRRFVTAEDARDCIADLRASGIQVIVGTGM
AIDFAEQAGLPGVLLYSADSVRLALDQAIALATAPSSAAPALRNATRRTRNQPAALLGED
TAMVQVRALVQLYAPHASTVLISGETGTGKELVARQLHAGSRRRGRFVAINCGAITESLL
EAELFGYSDGAFTGARRGGHTGLIEAAQDGTLFLDEIGELPLPLQTRLLRVLEEREVLRV
GATVPVPVDVRVVAASLQPLQTLVDQGRFRRDLFYRLAALRIDLPPLRNRPDDIALLLTH
YAQHGSETALPLSPAALQRLQQHAWPGNVRELRNLVERLCIHWKAQAQGQVSLAQLEAWA
PELADASTPAGYDSTSADAASSRAHLTATLVRAALERAQGNRASAAKALGVSRTTLWRWM
QAQELASSQ