Protein Info for Xcc-8004.3905.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF00111: Fer2" amino acids 28 to 80 (53 residues), 30.2 bits, see alignment E=3.5e-11 PF01799: Fer2_2" amino acids 95 to 167 (73 residues), 103.5 bits, see alignment E=5.4e-34

Best Hits

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to xcb:XC_3156)

MetaCyc: 45% identical to NdhB (Paenarthrobacter nicotinovorans)
Nicotine dehydrogenase. [EC: 1.5.99.4]; 1.5.99.4 [EC: 1.5.99.4]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9S5 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Xcc-8004.3905.1 Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT (Xanthomonas campestris pv. campestris strain 8004)
MNATPAAARDTAPATATTVAPTYPVALRINGQPYQLQLEAWVSLLDLLRDRLDLTGTKKG
CDHGQCGACTVLVDGRRINSCLTLAVMQDGADITTVEGLAEGEQLHPLQRAFIAHDAFQC
GYCTPGQLCSAVGLINEGQAHDRDQVRELMSGNICRCGAYPQITDAVMEVLGTPSDSSDS
ADTPWTPGTVPA