Protein Info for Xcc-8004.3829.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: LSU ribosomal protein L21p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00829: Ribosomal_L21p
  • amino acids 1 to 100 (100 residues), 121 bits, E=1.1e-39
• TIGR00061: ribosomal protein bL21
  • amino acids 2 to 100 (99 residues), 114 bits, E=1.9e-37

Best Hits

Swiss-Prot: 100% identical to RL21_XANCP: 50S ribosomal protein L21 (rplU) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02888, large subunit ribosomal protein L21 (inferred from 98% identity to xom:XOO_1506)

MetaCyc: 50% identical to 50S ribosomal subunit protein L21 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L21p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See Q4US34 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Xcc-8004.3829.1 LSU ribosomal protein L21p (Xanthomonas campestris pv. campestris strain 8004)
MYAVLVTGGKQYRVAQGETLRVEKLEVEAGNEIKFDTILMLGDSDGIKLGDALKGASVTA
KVVAHGRADKVRIIKFRRRKHHMKRQGHRQYYTEIEITGIAGGDKK