Protein Info for Xcc-8004.3821.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Lipoprotein signal peptidase (EC 3.4.23.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 47 to 64 (18 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 48 to 200 (153 residues), 133 bits, see alignment E=4.5e-43 PF01252: Peptidase_A8" amino acids 54 to 194 (141 residues), 138.5 bits, see alignment E=9.1e-45

Best Hits

Swiss-Prot: 100% identical to LSPA_XANC8: Lipoprotein signal peptidase (lspA) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to xca:xccb100_3182)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4US41 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Xcc-8004.3821.1 Lipoprotein signal peptidase (EC 3.4.23.36) (Xanthomonas campestris pv. campestris strain 8004)
MPAWGRSVGCPVRAILCCSRHPGLFSATEKASYLRYFDMSQRPNPSALIWLLLSAVVIGL
DQWSKAWVLSSLPEYTPVPVIDGFWNWYRTYNTGAAFSFLSDAGGWQLWFFTALAVGISG
LLAFWLSRTARGDWRSAVPYALVIGGAIGNVIDRLMHGHVVDFIQWYVGEHTWPSFNIAD
SAIVGGAIGIALFGLFDGKRSRKAG