Protein Info for Xcc-8004.38.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Alcohol dehydrogenase (EC 1.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to YAHK_ECOLI: Aldehyde reductase YahK (yahK) from Escherichia coli (strain K12)

KEGG orthology group: K13979, uncharacterized zinc-type alcohol dehydrogenase-like protein [EC: 1.-.-.-] (inferred from 100% identity to xca:xccb100_0032)

MetaCyc: 66% identical to aldehyde reductase, NADPH-dependent (Escherichia coli K-12 substr. MG1655)
Lactaldehyde reductase (NADPH). [EC: 1.1.1.55]; Alcohol dehydrogenase (NADP(+)). [EC: 1.1.1.55, 1.1.1.2]; 1.1.1.2 [EC: 1.1.1.55, 1.1.1.2]; 1.1.1.- [EC: 1.1.1.55, 1.1.1.2]; 1.1.1.- [EC: 1.1.1.55, 1.1.1.2]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

superpathway of anaerobic sucrose degradation (16/19 steps found)
3-methylbutanol biosynthesis (engineered) (6/7 steps found)
serotonin degradation (6/7 steps found)
ethanol degradation II (3/3 steps found)
pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
acetaldehyde biosynthesis I (1/1 steps found)
L-phenylalanine degradation III (3/4 steps found)
phytol degradation (3/4 steps found)
heterolactic fermentation (13/18 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-valine degradation II (2/3 steps found)
ethanol degradation I (1/2 steps found)
pyruvate fermentation to ethanol II (1/2 steps found)
mixed acid fermentation (11/16 steps found)
ethanolamine utilization (3/5 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
superpathway of N-acetylneuraminate degradation (15/22 steps found)
L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
salidroside biosynthesis (2/4 steps found)
L-methionine degradation III (1/3 steps found)
pyruvate fermentation to ethanol I (1/3 steps found)
pyruvate fermentation to ethanol III (1/3 steps found)
noradrenaline and adrenaline degradation (8/13 steps found)
acetylene degradation (anaerobic) (2/5 steps found)
phenylethanol biosynthesis (2/5 steps found)
cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
1,2-propanediol biosynthesis from lactate (engineered) (2/6 steps found)
superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
glycerol degradation to butanol (9/16 steps found)
(S)-propane-1,2-diol degradation (1/5 steps found)
butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
pyruvate fermentation to butanol I (3/8 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
detoxification of reactive carbonyls in chloroplasts (1/10 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (5/17 steps found)
L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.1

Use Curated BLAST to search for 1.-.-.- or 1.1.1.1 or 1.1.1.2 or 1.1.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X270 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Xcc-8004.38.1 Alcohol dehydrogenase (EC 1.1.1.1) (Xanthomonas campestris pv. campestris strain 8004)
MSKAHAYAAQTADQPLAPFVFERRAPGPDDVQIDIAYCGVCHSDLHTARNEWHNTVYPSV
PGHEIVGRVTAVGSAVTNFKVGDLAGVGCMVDSCRSCASCQEGEEQYCEQGFTGTYNGPM
FGGGENTYGGYSDHIVVDQKYVLHISHSDNLAAVAPLLCAGITTYSPLAHWKVGPGQKVG
VVGLGGLGHMAVKIAKAMGATVVLFTTSESKRADALRLGASEVVISKDEAQMAAQYNTLD
FILNTVAAPHNLDPFLNALKRDGAMVLVGVPEHSHPSPAVFNLVMKRRTLAGSLIGGIRQ
TQEMLDFCAKHNIVSDIETIRADQINEAYERMLKGDVKYRFVIDMDTLAKAA