Protein Info for Xcc-8004.3795.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Histidine kinase/response regulator hybrid protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 PF00072: Response_reg" amino acids 9 to 121 (113 residues), 70.4 bits, see alignment E=3.5e-23 amino acids 531 to 641 (111 residues), 68.3 bits, see alignment E=1.6e-22 TIGR00229: PAS domain S-box protein" amino acids 137 to 249 (113 residues), 32.6 bits, see alignment E=3.8e-12 PF08448: PAS_4" amino acids 145 to 244 (100 residues), 37.4 bits, see alignment E=6.7e-13 PF02518: HATPase_c" amino acids 393 to 508 (116 residues), 72.7 bits, see alignment E=8.2e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to xca:xccb100_3162)

Predicted SEED Role

"Histidine kinase/response regulator hybrid protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9Y8 at UniProt or InterPro

Protein Sequence (646 amino acids)

>Xcc-8004.3795.1 Histidine kinase/response regulator hybrid protein (Xanthomonas campestris pv. campestris strain 8004)
MVLPSSHRILVVDDNAVTRYSVRRVLEHHQFVVEEAGTGGEGLVRLAAEAFAAVVLDVNL
PDMSGFDIVRTLRAEPRTALLPVVHVSAASIATGDMITGLDAGADAYLIHPVDPNVLVAT
LRTLLRARNAEEALRLSEARFREIFEHIGAPIAVVDAQLHTQEANAAFQRLIGSATPCEA
INVPGLDQCATVQALTAALGRRERWSGTLSILRDGAVRETEWRVSPYREPDLGLLFVEDV
TEQRLREREQRQELDTATSELAHQIAERQRTEIQLLQAQKMEALGKLTGGIAHDFNNLLT
SIISGLDMIQLAVESNRIERVPRLAEIATGSAHRAAALTQRMLAFARKQSLDAQPFDVNA
RVRSLEDMLRRSIGENIALELQLAEAPLVAIADANQLENVVLNLVINARDALQGHGTIRI
QSAPHTAYNDPELEDGDYVAVNVIDDGSGIDPAILSQVFEPFFTTKPIGEGTGLGLSMTY
GFARQSGGTARITSTLGSGTTVALLLPRGLTVGEALPPPPPNAPRGRSQRILLVDDTDVV
RMMVSEVLSDAGYHVIEAENADGALAQLRADAQIDMVVSDVGLPGMNGRDMADVARDLRP
GLPILFITGYAENAATRQEFLAEGMALLPKPFSLNDLLNTVSRMLG