Protein Info for Xcc-8004.3786.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details PF01339: CheB_methylest" amino acids 14 to 190 (177 residues), 187.1 bits, see alignment E=1.2e-59

Best Hits

Swiss-Prot: 40% identical to CHEB2_LEPIN: Putative protein-glutamate methylesterase/protein-glutamine glutaminase (cheB2) from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to xca:xccb100_3156)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9K9 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Xcc-8004.3786.1 Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61) (Xanthomonas campestris pv. campestris strain 8004)
MSPATPQYLEFDAIVIGASAGGVMALQTLLSGLPATLPMPVLVVLHLPRDRPSQVAELLD
ARCALPVREAIDKQPLQPGTVTIAPPDYHLLVEGRDSLALSMDAPVLFSRPAIDPLFESA
ADVFGQRLLAILLTGASSDGSAGVAAVRTAGGSAWIQRPDDAASPLMPASALAHAGADAV
LTLQAICSRLEAFHA