Protein Info for Xcc-8004.3767.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 16S rRNA processing protein RimM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 TIGR02273: 16S rRNA processing protein RimM" amino acids 8 to 169 (162 residues), 175.3 bits, see alignment E=3.4e-56 PF01782: RimM" amino acids 10 to 91 (82 residues), 70.8 bits, see alignment E=9.7e-24 PF05239: PRC" amino acids 98 to 165 (68 residues), 34.1 bits, see alignment E=2.3e-12

Best Hits

Swiss-Prot: 100% identical to RIMM_XANCP: Ribosome maturation factor RimM (rimM) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02860, 16S rRNA processing protein RimM (inferred from 99% identity to xca:xccb100_3139)

Predicted SEED Role

"16S rRNA processing protein RimM" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4US83 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Xcc-8004.3767.1 16S rRNA processing protein RimM (Xanthomonas campestris pv. campestris strain 8004)
MKPTERRILLGRIVGAFGVKGELKLESWTEPRSAIFRYQPWIVRTPSGQESVLSGVRGRD
QGKNLIAVFPDITDRDTVEAMHGTEIYVARSALPPPKPDEYYWVDLEGLQVETVEGVKLG
TVSHLFSTGSNDVVVVRGDRERMIPFVLPEYVKSVDFEANLIVVDWDPDF