Protein Info for Xcc-8004.3760.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 873 TIGR01070: DNA mismatch repair protein MutS" amino acids 19 to 870 (852 residues), 1098.9 bits, see alignment E=0 PF01624: MutS_I" amino acids 20 to 131 (112 residues), 143.8 bits, see alignment E=6.3e-46 PF05188: MutS_II" amino acids 141 to 264 (124 residues), 109.6 bits, see alignment E=4.1e-35 PF05192: MutS_III" amino acids 281 to 570 (290 residues), 154.9 bits, see alignment E=8.7e-49 PF05190: MutS_IV" amino acids 439 to 530 (92 residues), 103.9 bits, see alignment E=1.2e-33 PF00488: MutS_V" amino acids 621 to 813 (193 residues), 276.4 bits, see alignment E=3.5e-86

Best Hits

Swiss-Prot: 100% identical to MUTS_XANCP: DNA mismatch repair protein MutS (mutS) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to xcb:XC_3035)

MetaCyc: 55% identical to DNA mismatch repair protein MutS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4US90 at UniProt or InterPro

Protein Sequence (873 amino acids)

>Xcc-8004.3760.1 DNA mismatch repair protein MutS (Xanthomonas campestris pv. campestris strain 8004)
LQTADTKDKTKLSTGAAEHTPLMKQFFAAKSDYPDLLLFFRMGDFYELFYDDARKAARLL
DITLTQRGSSGGAPIPMAGVPVHAYEGYLARLVALGESVAICEQIGDPALAKGLVERKVV
RIVTPGTVTDEALLDERRDTLLMAISRSKQGYGLAWADLAGGRFLVNEVDSVDALEAEIA
RLEPAELLVPDEDNWPEFLRGRVGVRRRPPWLFDADSGRRQLLAFFKLHDLSGFGIDDKP
CATAAAGALLGYVEETQKQRLPHLTSIAMEVASEAISMNAATRRHLELDTRVDGDTRNTL
LGVLDSTVTPMGGRLLRRWLHRPLRLREVLVQRHHAVGSLIDTGADTDVREAFRALGDLE
RILTRVALRSARPRDFSTLRDGLALLPKVRTILAPLDSPRLQTLYAELGEHDATAHLLIS
AVAEQPPLKFSDGGVIATGYDADLDELRRLSTNADQFLIDLEQRERASSGIATLKVGYNR
VHGYYIEISKGQAEKAPLHYSRRQTLTNAERYITEELKSFEDKVLSARERSLSREKLLYE
GLLDALGGELEGLKRCASALSELDVLAGFAERAQALDWSQPELESAPCLHIERGRHPVVE
AVRDQPFEPNDLDLHPDRRMLVITGPNMGGKSTYMRQNALIVLLAHIGSYVPASRAVIGP
IDRILTRIGAGDDLARGQSTFMVEMAETSYILHHATPQSLVLMDEIGRGTSTYDGLALAD
AVARHLAHTNRCYTLFATHYFELTALADASHAGGGSGIANVHLDAVEHGERLVFMHAVKD
GPANRSFGLQVAALAGLPKAAVQQARRRLAELEQRGGDSHAAEMAPAALDAPQQFGLFTA
PSSAAQEALQALDPDELTPKQALEALYRLKALL