Protein Info for Xcc-8004.3723.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR01026: ATPase, FliI/YscN family" amino acids 13 to 438 (426 residues), 555.3 bits, see alignment E=9.4e-171 TIGR02546: type III secretion apparatus H+-transporting two-sector ATPase" amino acids 23 to 439 (417 residues), 627.6 bits, see alignment E=8.9e-193 PF02874: ATP-synt_ab_N" amino acids 28 to 93 (66 residues), 34.9 bits, see alignment E=2.8e-12 PF00006: ATP-synt_ab" amino acids 150 to 359 (210 residues), 286.1 bits, see alignment E=2.6e-89 PF18269: T3SS_ATPase_C" amino acids 366 to 436 (71 residues), 79.9 bits, see alignment E=1.5e-26

Best Hits

Swiss-Prot: 90% identical to HRPB6_XANEU: Probable ATP synthase hrpB6 (hrpB6) from Xanthomonas euvesicatoria

KEGG orthology group: K03224, ATP synthase in type III secretion protein SctN [EC: 3.6.3.14] (inferred from 100% identity to xcc:XCC1236)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBB9 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Xcc-8004.3723.1 hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
MLAEMPLLQTTLERELAALAFGRRYGKVVEVIGTMLKVAGVQVSLGEVCELRQRDGTLLQ
RAEVVGFSRTLALLAPFGELVGLSRQTRVIGLGRPLAVPVGSALLGRVLDGLGEPADGQG
PLAGDDWVQIQAQAPDPMRRRLIEQPLPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLI
GMFARGTQCDVNVIVLIGERGREVREFIEMILGPDGLARSVVVCATSDRSSIERAKAAYV
GTAIAEYFRDRGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERA
GMGETGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAARNQYPAIDVLGSLSR
VMSQIVSAEQRQYAGQLRRLLAKHNEVETLLQVGEYRHGSDAVADEAIARIDAIRDFLSQ
PTDQLSDYDTILEQLAGVIDDA