Protein Info for Xcc-8004.3679.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Serine protease precursor MucD/AlgY associated with sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02037: peptidase Do" amino acids 53 to 520 (468 residues), 495.5 bits, see alignment E=7.1e-153 PF00089: Trypsin" amino acids 135 to 294 (160 residues), 70.7 bits, see alignment E=4.9e-23 PF13365: Trypsin_2" amino acids 138 to 273 (136 residues), 133.8 bits, see alignment E=2.4e-42 PF13180: PDZ_2" amino acids 314 to 403 (90 residues), 54 bits, see alignment E=5.2e-18 PF00595: PDZ" amino acids 325 to 391 (67 residues), 35.2 bits, see alignment E=4e-12 PF17820: PDZ_6" amino acids 341 to 392 (52 residues), 34.6 bits, see alignment 4e-12

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to xcb:XC_2972)

Predicted SEED Role

"Serine protease precursor MucD/AlgY associated with sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9B2 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Xcc-8004.3679.1 Serine protease precursor MucD/AlgY associated with sigma factor RpoE (Xanthomonas campestris pv. campestris strain 8004)
MNPRIRTQMFGLLAMTLPLAACAQQPEAPAKTSAPIAANRSTTPAPQLVAGLPDFTNLVE
QVGPGVVNIETTITRKDAMARSQRGGPGGRGGGAMPDDEQMPEFFKRFFGPDFQMPGGPR
QGPGQGDDDGGIAGKSMGSGFIISADGYVLTNHHVVDGASEVTVKLTDRREFKAKVVGSD
EQFDVALLKIEAKGLPTVRIGDSNTLKPGQWVVAIGSPFGLDHSVTAGIVSATGRSNPYA
DQRYVPFIQTDVAINQGNSGGPLLNTRGEVVGINSQIFSASGGYMGISFAIPIDLAFSAA
EQIKASGHVSRGMLGVAVGPIDTLKAQGLGLPDTRGALVNDIPAGSPAGKAGIEVGDVIR
SVNGKEIAVASDLPPMIGLMPPGTKVSLNVLRDGKPRQVTVTLGTLENESGSSAPRTAAD
DSKPSAPASVELLGLQVADLTAAERSRMGLEAGEGVRIASVTGSAARSTQPPLAPGLVIA
RVGRTKVGSVAELNRALASYKKGDVVMLLVTDGKATSYVALKAGG