Protein Info for Xcc-8004.3675.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Signal peptidase I (EC 3.4.21.89)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details PF10502: Peptidase_S26" amino acids 44 to 244 (201 residues), 187 bits, see alignment E=1.4e-59 TIGR02227: signal peptidase I" amino acids 49 to 246 (198 residues), 151.9 bits, see alignment E=7.3e-49

Best Hits

KEGG orthology group: K03100, signal peptidase I [EC: 3.4.21.89] (inferred from 100% identity to xcb:XC_2970)

Predicted SEED Role

"Signal peptidase I (EC 3.4.21.89)" in subsystem Signal peptidase (EC 3.4.21.89)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.89

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XB67 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Xcc-8004.3675.1 Signal peptidase I (EC 3.4.21.89) (Xanthomonas campestris pv. campestris strain 8004)
MKWFEIALVVLTLGTGFIWLLDKLFLAKRRAARAGLLDSEPAIIDYSRAFFPVLAVVLIL
RSFVAEPYKIPSSSMMPNLLIGDFILVNKFAYGFRLPITNTKFIPTGEPKRGDVVVFKPP
HAPDQNWIKRVVGLPGDKIGFHGDTLYINDKPMRYTVKGEYIGKGKGAEMTGTTLLVEDL
PGRTHTVLEWVDRNMPAGQGDWTVPADSYFVMGDNRDNSEDSRFWTQTHFLPEANLRGKA
FLIWLNCEGWFCKGSFDPSRIGTGIQ