Protein Info for Xcc-8004.3669.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 17 to 52 (36 residues), 22.7 bits, 4.1e-08
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 264 to 436 (173 residues), 190.2 bits, E=2.9e-60
• PF05958: tRNA_U5-meth_tr
  • amino acids 274 to 443 (170 residues), 84 bits, E=6.1e-27
• PF01135: PCMT
  • amino acids 282 to 356 (75 residues), 29.4 bits, E=3.8e-10
• PF00398: RrnaAD
  • amino acids 282 to 353 (72 residues), 28.3 bits, E=5.3e-10
• PF05175: MTS
  • amino acids 291 to 376 (86 residues), 30.7 bits, E=1.3e-10
• PF01189: Methyltr_RsmB-F
  • amino acids 292 to 383 (92 residues), 27.3 bits, E=1.5e-09
• PF02475: Met_10
  • amino acids 293 to 360 (68 residues), 21.4 bits, E=1.1e-07
• PF13847: Methyltransf_31
  • amino acids 296 to 374 (79 residues), 49 bits, E=3.2e-16
• PF03602: Cons_hypoth95
  • amino acids 298 to 376 (79 residues), 26.6 bits, E=2.4e-09
• PF13649: Methyltransf_25
  • amino acids 301 to 356 (56 residues), 35.9 bits, 5.7e-12
• PF08241: Methyltransf_11
  • amino acids 302 to 356 (55 residues), 23.4 bits, 4.3e-08

Best Hits

Swiss-Prot: 100% identical to RLMD_XANC8: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to xcb:XC_2964)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q4USG1 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Xcc-8004.3669.1 23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-) (Xanthomonas campestris pv. campestris strain 8004)
VARSRNRFDRTPFQTAITDLSHDGRGVARRDGEGGKVTFISGALPGEVVVAEPTARSRHF
DEAKTVEVLQASPQRVAPRCPHFGVCAGCVLQHLEESQQIVAKQRVLMDNLERIGHVTPQ
TVLPALVGDTWGYRRKGRFSVRRVEKKDKTLVGFRELDPRFVADLSVCYTVIPQIGEKIP
QLAALVEGMDGKRDIPQIEFIAGDDAVALTIRHLQPLSARDEQALVEFAQAHDFAIFLQP
GGVDSVHPLWPQEVPLSFRLPKWDVELAFRPLDFIQVNASLNQKMIAHALALLDAKPDDR
VLDLFCGLGNFTLPLARTVREVVGVEGDAGLVARARENAQRNGLDNAQFYAADLTQDQRQ
TAWMRQGFDKLLLDPPRSGAIDVLQQLPLKQFKRIVYVSCHPGSLARDAGYLVNEQGFSL
LSAGAMDMFPHTAHVESIAVFEKR