Protein Info for Xcc-8004.3662.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00156: Pribosyltran
  • amino acids 16 to 170 (155 residues), 66.8 bits, E=7e-23

Best Hits

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 99% identity to xoo:XOO1868)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (12/14 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• adenine salvage (2/3 steps found)
• guanine and guanosine salvage I (1/2 steps found)
• xanthine and xanthosine salvage (1/2 steps found)
• adenine and adenosine salvage III (2/4 steps found)
• superpathway of guanine and guanosine salvage (1/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See A0A0H2X9N9 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Xcc-8004.3662.1 Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8) (Xanthomonas campestris pv. campestris strain 8004)
MSTLTISQALAQADLLVDRPAIDAAVATIADAIARDYAGEVPVYLTIMHGALPFSGQLAL
ELGARGQDLQFDYLHATRYRGETTGGELVWKHRPATALFGRRVILVDDILDEGYTLQGVR
QWCLEQGATDVRVAVLTVKRHDRCVPGVTADYVGVEVADRYVFGFGMDVNEQLRGIPAIY
AMKQ