Protein Info for Xcc-8004.3651.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details PF05227: CHASE3" amino acids 40 to 174 (135 residues), 103.2 bits, see alignment E=2.2e-33 PF13185: GAF_2" amino acids 255 to 386 (132 residues), 31.2 bits, see alignment E=4.8e-11 PF01590: GAF" amino acids 256 to 386 (131 residues), 29.2 bits, see alignment E=2.4e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 395 to 559 (165 residues), 183.5 bits, see alignment E=1.3e-58 PF00990: GGDEF" amino acids 400 to 557 (158 residues), 162 bits, see alignment E=2.2e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to xca:xccb100_3008)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X991 at UniProt or InterPro

Protein Sequence (578 amino acids)

>Xcc-8004.3651.1 Sensor histidine kinase (Xanthomonas campestris pv. campestris strain 8004)
MPSSFTSRRRNQLALVFSALIFIAIGIGIFIGARRSLADAALVSHTHEVIGRVDEIQARV
LDAESAERGYLLTGNDAYLLDYQTSVERLPILIGNLRRKIADNPSQVAHLDQLHHLVDTR
LKQIQHVLDVYADSGLEPARTSIRQTAFRTTSVIREQALTMVQREQELLALRAESSRQSA
LLLLILALAGIPLGLAVVGTVYGLLMRELRHRAQAERHAARANQELGESIGALQRSAADL
NLLSRYTGLLQSCVSAEEALDVTSRTLAHLLPGIAGSVYLLRASQDRAEVISHWGTPLVH
SASHLLPEECWALRRGQPHLIEDLARDAPCAHIDLPDASVAITTACLPMSAQGTQLGFLF
LSAPGPAPMPRLEIAEAAAEQLSLALSNLRLRESLRRQSIRDALTGLYNRRYLEEALSHE
LARCARRDLPLSVLMLDVDHFKQFNDGQGHAGGDLLLAAVGELLLTRLRAEDVACRYGGE
EFTVILPETDGEEAMRVAEQIRGHIAALAVSDGQRALPRVTASIGVASFPADGELGSALI
QKADAALYVAKRQGRNRVERHGAVAVNAEPVGTNGAIV