Protein Info for Xcc-8004.3614.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 907 transmembrane" amino acids 70 to 89 (20 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 294 to 319 (26 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 350 to 368 (19 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 451 to 468 (18 residues), see Phobius details amino acids 474 to 490 (17 residues), see Phobius details amino acids 510 to 530 (21 residues), see Phobius details amino acids 550 to 570 (21 residues), see Phobius details PF09924: LPG_synthase_C" amino acids 595 to 881 (287 residues), 330.8 bits, see alignment E=3.4e-103

Best Hits

KEGG orthology group: K14205, phosphatidylglycerol lysyltransferase [EC: 2.3.2.3] (inferred from 99% identity to xca:xccb100_2974)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9J4 at UniProt or InterPro

Protein Sequence (907 amino acids)

>Xcc-8004.3614.1 hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
MCRPDRTLCSPSTGAHATTLHALPRCPAHADPSHLLPPRRVRTPLLSADPVAPMTDTPVP
SEATASGWRRALPVIISLAILAMALHALSSQFTDHGYRQIRQAFRALGAGQIALTLLLGL
SSYACLVGFDWVGLKRTGKRLHPARVGITAFMAHAVGQTLGFAALTGGAVRLRGYGSVGL
TLAEIGQVVLMSTLGFIFGAWVLLGIALMLEPEAAARALPIAAEGIRIAGIALLAGYLAM
LVLVGRHGREFGIRSHRFWLPDRTTVLGVTALSVVELGLAAAAFYVLLPPDPGTGYFGFI
GIWLVAVVAGLISTVPAGLGVFEWSLLKLLPHVTPAAVLAAALAYRVTYYIVPLLISVAM
AAATGLRAPVRASASTARTVWKTLRPWLPQILALAVFAVGAALVIDGTLPTPRARQEVAP
LPLIETSHLLVSLGGMLLLLIGQGLQRRSHSAWVLALGVCVLLPPLSLLRGSHISVSLSA
ALAAVALWAARREFYRQGALLDEAWSWRWLSNLGLVLVATFWLLFFVYSHVEYSNDLWWQ
FATSANAPRALRALLILCVGVILFGTARLLRGGRRPMPPADAQALQALAPVLASSADTQA
CLALTGDKAFLRDEKGLGFVMMQRYGGSLISMGDPVGPPEVARALIWRFREEADHMGLRP
VFYQVGEKYWQTYLDMGLTLVKLGEEAIVPLEGFTLEGRDRADLRQAWNRGKRGGLSFRM
LQPEQVDAVMAELGEVSEQWLDEKAGEEKGFSLGSFDPDYLRRFPMAVAEAEGKIVAFAN
VWCAPAGGELSVDLMRHSAQAPKGTMDFLFIELFLWGHANGYTRFSLGMAPLSGLAEHRL
AGRWNRFASLVARHGERFYGFSGLRRFKSKFAPTWRPRYLVAPGGMHLPAALLDVTRLIS
VDPGRQD