Protein Info for Xcc-8004.3598.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Ferredoxin II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 6 to 137 (132 residues), 216.6 bits, see alignment E=1.1e-68 PF04060: FeS" amino acids 16 to 48 (33 residues), 55.6 bits, see alignment 1e-18 PF14697: Fer4_21" amino acids 81 to 135 (55 residues), 61.6 bits, see alignment E=1.9e-20 PF00037: Fer4" amino acids 82 to 103 (22 residues), 26.7 bits, see alignment 1.1e-09 amino acids 117 to 134 (18 residues), 24.1 bits, see alignment (E = 7.4e-09) PF12838: Fer4_7" amino acids 88 to 132 (45 residues), 27.7 bits, see alignment E=9.4e-10 PF13187: Fer4_9" amino acids 88 to 133 (46 residues), 32.4 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 100% identity to xca:xccb100_2960)

Predicted SEED Role

"Ferredoxin II"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XB13 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Xcc-8004.3598.1 Ferredoxin II (Xanthomonas campestris pv. campestris strain 8004)
MPTSLPTLVERLDRLLPQTQCGQCGFDGCRPYAQAMAEGKATIDHCPPGGDAGARALAQV
LQVPARPYDRSRGTHLPPQVAWIVEADCIGCTKCIQACPVDAIVGGAKHMHTVIAPLCTG
CELCVPACPVDCIELRVVG