Protein Info for Xcc-8004.3554.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Translation elongation factor Ts

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR00116: translation elongation factor Ts" amino acids 1 to 289 (289 residues), 332.5 bits, see alignment E=1.1e-103 PF00889: EF_TS" amino acids 70 to 272 (203 residues), 236.8 bits, see alignment E=9.1e-75

Best Hits

Swiss-Prot: 100% identical to EFTS_XANCP: Elongation factor Ts (tsf) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02357, elongation factor Ts (inferred from 100% identity to xca:xccb100_2923)

Predicted SEED Role

"Translation elongation factor Ts"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4USR1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Xcc-8004.3554.1 Translation elongation factor Ts (Xanthomonas campestris pv. campestris strain 8004)
MEITASLVKELRERTGAGMMECKKALVENAGDIDAAAEWLRKSGLAKADKKADRVAAEGR
IATAQAGGKAVLVEVNSETDFVAKDENFLAFTDVVANAALNSDATDADALKSVKLDSGET
IEERRAAVIAKVGENLQVRRLVRIDSANNVAAYVHGGRIGVLVELKGGDAELARGIAMHI
AAMNPPHVKASDVPAEFVAKEKEIELAKMSEKDKAKPAEILEKIISGKISKIVNEVTLYG
QPYVLNTDQTVEQAVKAAGAEVIGFQRLAVGEGIEKVVEDYAAEVMKQAGLA