Protein Info for Xcc-8004.351.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: tRNA pseudouridine synthase A (EC 4.2.1.70)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF00849: PseudoU_synth_2" amino acids 2 to 148 (147 residues), 77.3 bits, see alignment E=7.7e-26 TIGR00093: pseudouridine synthase" amino acids 6 to 176 (171 residues), 169.1 bits, see alignment E=3.4e-54

Best Hits

Swiss-Prot: 100% identical to RLUE_XANCP: Ribosomal large subunit pseudouridine synthase E (rluE) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K06181, ribosomal large subunit pseudouridine synthase E [EC: 5.4.99.12] (inferred from 100% identity to xca:xccb100_0298)

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X2Y4 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Xcc-8004.351.1 tRNA pseudouridine synthase A (EC 4.2.1.70) (Xanthomonas campestris pv. campestris strain 8004)
MLVLLNKPYGVLSQFSDRSTPPKRTLAEFGLPPQVYAAGRLDHDSEGLLLLTDDGPLAHR
LTDPRHKQPKTYWVQVEGDPDTSQLQALCDGVLLNDGPTRPANVRRLECAPTLWPRDPPV
RVRKTVPDAWLEVQITEGRNRQVRRMTASVGLPTLRLVRVAIGAWSLASLQPGQWRVDDA
RAVRPAR