Protein Info for Xcc-8004.3507.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Lipid A export ATP-binding/permease protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 transmembrane" amino acids 65 to 80 (16 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 198 to 229 (32 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details PF00005: ABC_tran" amino acids 413 to 566 (154 residues), 121.9 bits, see alignment E=3.2e-39

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to xcc:XCC1415)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XAU7 at UniProt or InterPro

Protein Sequence (641 amino acids)

>Xcc-8004.3507.1 Lipid A export ATP-binding/permease protein MsbA (Xanthomonas campestris pv. campestris strain 8004)
VAPNTPSARGPRHTMPMSASRPGASAPAPRTGPTLRERFDALRNLPPFLRHIWQTSRWLS
ASSIGLRVLRALMPIATLYIGKLIIDEAIHLVGQPPAFDSLTQALASGRLNRLLELLALE
LALAIGSDLLGRLVGYADALLSELFNNAASVRLMEHAAQLDLEDFEDPDRQDKLDRARRQ
TMNRMNLMSQLFGQVQDAITVASLAVGLLVYAPWLIVLLAIALIPAFIGEAHFNALGYSL
NFQWTPERRQLDYLRQVGASVETAKEVKILNLHRFLITRYRRLADKFFQANRALARKRAL
WGALLAALGTLGYYAAYGYIAWRTVRGDFSIGDLTFLAGSFLRLRQLLEGLLIGFSQVAG
QALYLDDLYSFFNIVPEIRSRPNALPVPRPIRQGFVFEDVGFRYPEAEHWTMQHLNFELR
AGEVLALVGENGAGKTTLVKLLARLYDPDEGRILLDGHDLRDYDLDDVRANLGVIFQDFV
RYHLSIGENIGVGQVDAMDDTDRIRTAAQRAMATELIDSLPDGYNQLVGRRFKNSVDLSG
GQWQKIAIARAYMRDAQLMILDEPTAALDARSEFEVFQRFKELSDNRTAVLISHRFSSVR
MADRILVLADGRIEASGTHAELMAQGGRYAELFELQAAGYR