Protein Info for Xcc-8004.3465.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: COG2885: Outer membrane protein and related peptidoglycan-associated (lipo)proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details PF13677: MotB_plug" amino acids 12 to 36 (25 residues), 25.3 bits, see alignment (E = 8.9e-10) PF00691: OmpA" amino acids 94 to 165 (72 residues), 29 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC1451)

Predicted SEED Role

"COG2885: Outer membrane protein and related peptidoglycan-associated (lipo)proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X945 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Xcc-8004.3465.1 COG2885: Outer membrane protein and related peptidoglycan-associated (lipo)proteins (Xanthomonas campestris pv. campestris strain 8004)
MFGSMARGRRRNKDDGEKPFWISYADLMTAMMVLFLSAMAVTIAAVTRVVEGPAEIRARE
IQSVCEQLGRDLSGVSEIQINCADQRISFPTVGTFGFNSYRLPAEADGALAQLVPAVLNA
ADGELGKKWLKQVVVEGYTDTKGGYLYNLHLSLQRSEWVLCLLMDPSKNKSLALSDEQLS
RVRKLFLAGGVSFNNQRTTADESRRVELRIQFYGVDEPHSAHLDTGSDFMAGADRCQL