Protein Info for Xcc-8004.3460.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF13276: HTH_21" amino acids 38 to 87 (50 residues), 44.6 bits, see alignment 2.7e-15 PF00665: rve" amino acids 102 to 199 (98 residues), 84.9 bits, see alignment E=8.3e-28 PF13683: rve_3" amino acids 187 to 253 (67 residues), 108.8 bits, see alignment E=1.8e-35 PF13333: rve_2" amino acids 206 to 257 (52 residues), 22.4 bits, see alignment 2.2e-08

Best Hits

Swiss-Prot: 80% identical to YI61_XANEU: Insertion element IS476 uncharacterized 39.2 kDa protein from Xanthomonas euvesicatoria

KEGG orthology group: None (inferred from 99% identity to xca:xccb100_2824)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>Xcc-8004.3460.1 Mobile element protein (Xanthomonas campestris pv. campestris strain 8004)
MCELTSISERRACRLAGISRDAFRHAPTPTPATQTLSARLVELAQARRRFGYRRLHDLLR
PEFPQVNHKKIYRLYREAKLSVRRRKKAKFPAAQRQPLRPARHPNEVISMDFVFDQLASG
RRIKCLTVADDFTHECVDIAVDHGISGAYVVRVLEQIACFRGYPRAVRTDNGPEFTSRAF
ITWAQQRGIEHILIEPGKPMQNGYIESFNGKFRDECLNEHWFTSLIQAREVIADWRRDFN
EVRPHSSCGRIPPAQFASNHRAQTGNNAVPFNPGLYQ