Protein Info for Xcc-8004.3431.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: DNA repair protein RecN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 PF02463: SMC_N" amino acids 30 to 536 (507 residues), 70.1 bits, see alignment E=1.9e-23 TIGR00634: DNA repair protein RecN" amino acids 30 to 581 (552 residues), 478.3 bits, see alignment E=2.2e-147 PF13476: AAA_23" amino acids 34 to 132 (99 residues), 33.9 bits, see alignment E=5e-12

Best Hits

Swiss-Prot: 72% identical to RECN_XYLFA: DNA repair protein RecN (recN) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K03631, DNA repair protein RecN (Recombination protein N) (inferred from 100% identity to xca:xccb100_2802)

Predicted SEED Role

"DNA repair protein RecN" in subsystem DNA-replication or DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X926 at UniProt or InterPro

Protein Sequence (583 amino acids)

>Xcc-8004.3431.1 DNA repair protein RecN (Xanthomonas campestris pv. campestris strain 8004)
MSGPGVGKHPIPPASPSALSFPKAFTLDPMLRHLSIKDFAVVRATELEFGPGMTVVSGET
GAGKSLMVDALGFLSGLRADSGVVRHGADRAELSAEFQLPAEHPGLTWLADNELDDDAQC
QLRRIIRADGGSRAWINGRPVTSSQLSDLAARLVEIHGQHEHQALMARNSQLALLDAYAR
NSAQREQVRQASQRWQALLDERDALSAQGDVSDRIGFLEHQLAELEREDLDPAAIAALDT
NHRRQAHATALIGACESVVQQLNGDEGPSALGLLQDSRHDLARVAEHEPRLGEVDALLDS
AAIQIEEALALLDRVRDDLDADPTQFEAMERRLGRLHDLARKHRVSPDELAAHRDHLTAE
VESLRGADERLQQLDKHIAAAIGVWQGAASVLSASRQSAAQALSAATTTLIGELGMGGGQ
FLIQLQPQETLRPDPNGAERVEFLVAANAGQPPRALRKVASGGELSRISLAIEVAALGLD
SVPTMVFDEVDSGIGGAVADIVGQKLRALGEERQVLCVTHLPQVAAKGHAHYRVSKAPVD
GMTQSAVELLGPQARQEELARMLGGVEVSKEARAAARKLLQSA