Protein Info for Xcc-8004.3429.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Heat shock protein GrpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF01025: GrpE" amino acids 12 to 170 (159 residues), 162.2 bits, see alignment E=4.5e-52

Best Hits

Swiss-Prot: 100% identical to GRPE_XANCP: Protein GrpE (grpE) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03687, molecular chaperone GrpE (inferred from 98% identity to xcv:XCV1563)

Predicted SEED Role

"Heat shock protein GrpE" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X948 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Xcc-8004.3429.1 Heat shock protein GrpE (Xanthomonas campestris pv. campestris strain 8004)
MNQDHPEFDSEDLSQNPPETDPLKAEIESLRSEIALVKADALRERADLENQRKRIARDVE
NARKFANEKLLGELLPVFDSLDAGLTAAGTEPSPLRDGLDLTYKQLLKVAADNGLTLLDP
VGQPFNPDQHQAISQGEAEGIAPGHVVQVFQKGYLLNERLLRPALVVVAKHD