Protein Info for Xcc-8004.3414.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 4 to 475 (472 residues), 502.7 bits, E=4.7e-155
• PF07992: Pyr_redox_2
  • amino acids 5 to 338 (334 residues), 219.8 bits, E=2.8e-68
• PF03486: HI0933_like
  • amino acids 5 to 36 (32 residues), 23.2 bits, see alignment (E = 1.4e-08)
• PF00890: FAD_binding_2
  • amino acids 6 to 41 (36 residues), 26.1 bits, 2.5e-09
• PF01134: GIDA
  • amino acids 6 to 61 (56 residues), 29.8 bits, 1.7e-10
• PF00070: Pyr_redox
  • amino acids 183 to 262 (80 residues), 66.5 bits, E=1.3e-21
• PF02852: Pyr_redox_dim
  • amino acids 357 to 465 (109 residues), 129.8 bits, E=2.6e-41

Best Hits

Swiss-Prot: 60% identical to DLDH_PSEFL: Dihydrolipoyl dehydrogenase (lpd) from Pseudomonas fluorescens

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to xcc:XCC1485)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See A0A0H2X8R2 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Xcc-8004.3414.1 Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4) (Xanthomonas campestris pv. campestris strain 8004)
MSEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAAIGKDGKPALGGTCLRVGCIPSKAL
LDSSRQFWNMGHLFGDHGISFNDAKMDVPTMIGRKDKIVKQFTGGIAMLFKANKITPYYG
FGQLQPGNIVKVTQHEGGEIELKGTNVILAAGSESIELPFAKFDGDTIVDNVGGLDFTAV
PKRMAVIGAGVIGLELGSVWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIK
LGAKVSKTEITGSGDAKQVVLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLADGTGVKLT
ERGQIEVDGHCHTGVDGVWAIGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWV
IYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAVAMGEPAGFVKVIADAETDRVLG
MHLVGVGVSELVHEGVLTMEFSGSADDLARICHAHPTLSEAIHDAAMAVSKRAIHKAN