Protein Info for Xcc-8004.3370.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 3'-to-5' exoribonuclease RNase R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 841 TIGR02063: ribonuclease R" amino acids 121 to 817 (697 residues), 861.1 bits, see alignment E=6.4e-263 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 176 to 816 (641 residues), 695.6 bits, see alignment E=6.3e-213 PF08206: OB_RNB" amino acids 187 to 244 (58 residues), 78.8 bits, see alignment 3.9e-26 PF17876: CSD2" amino acids 264 to 338 (75 residues), 74.7 bits, see alignment E=1e-24 PF00773: RNB" amino acids 360 to 687 (328 residues), 362.4 bits, see alignment E=5e-112 PF00575: S1" amino acids 735 to 814 (80 residues), 42 bits, see alignment E=2e-14

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 100% identity to xcb:XC_2718)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8X8 at UniProt or InterPro

Protein Sequence (841 amino acids)

>Xcc-8004.3370.1 3'-to-5' exoribonuclease RNase R (Xanthomonas campestris pv. campestris strain 8004)
MTKKNTPDSDRPSRRKSASPGESSTAEQQKLPGWMPDFLVRAAAGASTKSANKRAAAKAS
SDQPAPPVEPAAPRAPHPRKSGPPAPPPERFQKDAVQAVADTGFKDPHADREALRYAEPI
ASREAILQLLEDCDGPQTAEEIAEQLGLSDRIDALGKRLAAMVREAQLVQNRRGGYAPVQ
QTSLIAGVVIANPEGFGFLKPDEGGDDLFLPPFEMRKVMHGDRALANVTGIDRRGRREGA
IARVLERRMSRMIGRFFYEHGVAYVDPDDKRVQRNVQIAPDGIGEAREGQLVVCELIAPP
DARRPAIGKIIAVLGDKLTPSLVVEMAIHGHELPHEFPQEVLDEAAAVPLVVEPQMIGGR
VDLRQMPLVTIDGEDAKDFDDAVYCEPNADGFRLVVAIADVSNYVRPGTPLDDEAQKRAT
SVYFPGFVVPMLPETLSNGICSLMPKVDRMCFVCDMQVGRDGEVTGSRFYEAVMNSHARL
TYNQVWKAVGEDDADTKAFIGPLLPQVQRLHQLYNVLSKARTHRGAIEFETSEVRFVLDN
TGEVTQAGMLVRNDAHKLIEECMIAANVEAARYLLSMHVPAPYRVHERPPESKYEDLLEF
LKEFQLSLPAWSKVRPGDYTKLLKKVRARPDAALLESVLLRSQSLAVYSPENNGHFGLAL
EAYAHFTSPIRRYPDLLVHRAIKHALTGASPEKYIYAPRQMAALSLQCSERGRRADEAER
EVDERYRAAWMEKHVGGQFDGVISGVTSFGLFVELTQSKVNGLVHVTQLPQDYYQFDPIR
KTMTGERRGREFRLGDPVRVLVLKASMEERKIDFRLAEEGAPAEAPLPPREKPAKRKKKP
Y