Protein Info for Xcc-8004.3361.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Phosphate transport system permease protein PstC (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 83 to 108 (26 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 234 to 257 (24 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 25 to 317 (293 residues), 302.6 bits, see alignment E=1.2e-94 PF00528: BPD_transp_1" amino acids 104 to 312 (209 residues), 46.9 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 85% identical to PSTC_XYLFA: Phosphate transport system permease protein PstC (pstC) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 100% identity to xca:xccb100_2735)

MetaCyc: 51% identical to phosphate ABC transporter membrane subunit PstC (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8Z6 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Xcc-8004.3361.1 Phosphate transport system permease protein PstC (TC 3.A.1.7.1) (Xanthomonas campestris pv. campestris strain 8004)
MNATAIPEAMTAPRGRDLRDARADRLFKLALAATVVFVLLALGSAALSMLWGGRHALQMQ
GLSFFYSADWNPVENKYGALAPIYGTLVTALIAMVIAVPVSFGIAFFLTEVAPRWLRGPV
GTAIELLAGIPSIIYGMWGLFVLVPVMTEHVTPWLNDNLGTLPLIGKLFQGPPLGIGLLT
AGFVLAIMVIPFISSVMREVFLTVPTRLKESAYALGSTKWEVSWDIVLPYTRSAVIGGVF
LGLGRALGETMAVAFVVGNTVRLSPSLLEPGTTIAALIANDFGEATETYRSALLLLGFVL
FIVTFIVLAIARFMLMQLSRREGN