Protein Info for Xcc-8004.3359.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF12849: PBP_like_2" amino acids 47 to 331 (285 residues), 128.7 bits, see alignment E=1.8e-41 TIGR00975: phosphate ABC transporter, phosphate-binding protein PstS" amino acids 51 to 359 (309 residues), 410.3 bits, see alignment E=2.4e-127

Best Hits

Swiss-Prot: 68% identical to PSTS_XYLFT: Phosphate-binding protein PstS (pstS) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to xcc:XCC1528)

MetaCyc: 55% identical to phosphate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XAJ0 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Xcc-8004.3359.1 Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1) (Xanthomonas campestris pv. campestris strain 8004)
LRRTPLPCNGVLRDVIPIATRSCSVISSIKSRLAVGVLAAALAMGAQAADVTGAGASFIY
PVMSKWSADYNTATKKQVNYQSIGSGGGIAQIKAASVDFGSSDAPLKPEELAAAGLAQFP
SVIGGVVPVINVPGIAAGAVKLDGKTLGDIFLGKVTTWNDAAIVALNPGVKLPDSKITVV
HRSDGSGTSFNFTNYLSKVNPDWKSKVGEGTAVQWPTGIGGKGNEGVAAYVKQIKGGIGY
VELSYALQNKMAYTAMKNAAGKFVQPSDETFAAAANSADWGSSKDFYLVMTNAAGDNAWP
ITATNFILVQKKPKNPAGLKNTLEFFRWVYSKGDAQAKALDYVPLPDTLVSQIEAYWAKT
LPR