Protein Info for Xcc-8004.3326.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG01212390: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 61 to 85 (25 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 411 to 428 (18 residues), see Phobius details amino acids 454 to 476 (23 residues), see Phobius details amino acids 485 to 520 (36 residues), see Phobius details amino acids 531 to 550 (20 residues), see Phobius details PF04632: FUSC" amino acids 415 to 738 (324 residues), 56.8 bits, see alignment E=2.7e-19 PF13515: FUSC_2" amino acids 421 to 545 (125 residues), 71.3 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: None (inferred from 98% identity to xca:xccb100_2706)

Predicted SEED Role

"FIG01212390: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8W9 at UniProt or InterPro

Protein Sequence (747 amino acids)

>Xcc-8004.3326.1 FIG01212390: hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
VRACAPCAGTLCRRRGLSRGPWGVPASANHLVSADLHAMLRALIDLKPRDVPLRVALRNT
AAVVLPLLIGVATGHVAAGLAVCSGALNTMFSDQPGPYRARLQRMLMAALAAGGAALLGI
WVGHNTPALVLAGLLLGLGGGLLVALGPVAARVGLTSMILLVVSADMRLPVAQAPGVALL
IFAGGVLQVLLALAAWPLQRYRPERFALAELMRQLASIARQRPEASAPPPATQEVLDAMV
MLHGEHRSRAIAVQSFRIIAELCDRVRLELLSLADADTRLGQSQARPAIERVLERSAIVL
EQLAHAMTVGEDPAAATASMTDFDDLVAALAQFQHDNADTRERRLVRVAVARAQGLGGQL
RALVRNAHWASSRGEIQAQLAEARLPAALRPAATWATLRANLDLSSVAFRHALRCGVCLA
LAIAFQRWQQIPHGFWIPMTTAIVLKPDFGGTFSFGALRVAGTFIGLLLATLLAHLAMDG
AGIRLSLLALFCLGFRLLTQVNYGIGVAFLTGMLVLLLSFEGVSPGEAVGARLQATVAGS
ALALIAYALWPTRERRQIRASLAQLLDAYRAHLRNLLLGQLDALSDSRAAARVARTNTQA
SIERLRGEPRSRRNLDELKRAESLLANGNRLIRATLSLEAELRDGHPLPALNGLPAFAEQ
ADQALAELSACLREGRVPAPATLRTAERGVSDALAALPDGLPAAAALADTIDRITDSIGT
LTHLLRPARRATAEAQAVHDGAQGAGR