Protein Info for Xcc-8004.326.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG138928: iron-regulated membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 197 to 222 (26 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 390 to 409 (20 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 450 to 469 (20 residues), see Phobius details amino acids 481 to 504 (24 residues), see Phobius details PF03929: PepSY_TM" amino acids 10 to 370 (361 residues), 227.3 bits, see alignment E=1.9e-71

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_0261)

Predicted SEED Role

"FIG138928: iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X2N4 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Xcc-8004.326.1 FIG138928: iron-regulated membrane protein (Xanthomonas campestris pv. campestris strain 8004)
MKQGFRQSMAWLHTWTGLLVGWVLLLIFMGGTASYYRDELSRWMRPELPTTTVSSAVAMR
SAERYLQTHAPDAQSWNITLPDARTPVVTMYWQNPAPPPGKTLSRRELYGNAIIDPATGN
PISARDTLGGDFFYRLHFDLHYLPVVWARYIVGFCAMFMLVAIISGVITHKKIFKDFFTF
RPGKGLRSWLDFHNVSAVTALPYHAMITYTGIVTLMFMYLPWGIKAQYPDNEMRFYEESA
NRVADTRTAAGTPARMRPLEEFVARARSDWRGDDVGTVAVSLPNDAHAAVGVTQRADDLS
NDAPSILYDAVSGQRLQYSGAPGGASQTRGVMVGLHIAHFAGGWMRALFFGSGLLGCLMV
ASGVVMWAVKERPKHAKAGRIGFGLRLVDALNIGTVAGLPIAFAAFFWANRLVPVALEAR
AAMEAHLFFAAWGGALLAAFVWPRRAMWSWQLYLGAGLFALVPLLNALTTDLHLGVTVPA
GQWALAGVDLVCLGLGVCLGIAGWRLQHWKAPQSAAARKARAQATPAPQNALPVQEGA