Protein Info for Xcc-8004.325.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG016502: iron uptake protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 61 (18 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details PF11804: DUF3325" amino acids 4 to 104 (101 residues), 98.8 bits, see alignment E=9.3e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC0250)

Predicted SEED Role

"FIG016502: iron uptake protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X4A2 at UniProt or InterPro

Protein Sequence (111 amino acids)

>Xcc-8004.325.1 FIG016502: iron uptake protein (Xanthomonas campestris pv. campestris strain 8004)
MSVVLLLALNFSGFAALCLAMEKHQHEVRGRALGMTRSRQLRALGWLLLLVTFALAVSAQ
GWGIGSVLWLGTLSAGAAVLSLWLLPYRRGLILPAAIAAPVVAGMAFALLH