Protein Info for Xcc-8004.3220.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF13276: HTH_21" amino acids 106 to 159 (54 residues), 42.1 bits, see alignment 1.7e-14 PF00665: rve" amino acids 173 to 270 (98 residues), 81.2 bits, see alignment E=1.2e-26 PF13683: rve_3" amino acids 259 to 324 (66 residues), 98.4 bits, see alignment E=3e-32 PF13333: rve_2" amino acids 277 to 330 (54 residues), 28.4 bits, see alignment 3e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to xcv:XCVd0022)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>Xcc-8004.3220.1 Mobile element protein (Xanthomonas campestris pv. campestris strain 8004)
VPAAWLQRGLVLPVAQQVRWDERARCQAAQGPRVRERAAEEVAGRAVVRERPDQGCTAKK
VVSAPARRTLVREWIGRGASERRALAVIGMSASALRYCPREDRNGELRERICALAHRHRR
YGVGMIYLKLRQEGRIVNYKRVERLYREQQLQVRRRKRKKVPIGERQPLLRPSQANQVWS
MDFVFDRTAEGRVIKCLVIVDDATHEVVAIEVERAISGHGVTRVLDRLAHSRGLPKVIRT
DNGKEFCGKAMVAWAHARNVQLRLIQPGKPNQNAYVESFNGRLRDECLNEHWFPTLLHAR
TEIERWRREYNEDRPKKAIGGMTPAAYAQHLAP