Protein Info for Xcc-8004.3174.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 23 to 365 (343 residues), 368.8 bits, E=3.4e-114
• PF00266: Aminotran_5
  • amino acids 61 to 172 (112 residues), 23.5 bits, E=2.6e-09

Best Hits

Swiss-Prot: 56% identical to FDTB_ANETH: dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (fdtB) from Aneurinibacillus thermoaerophilus

KEGG orthology group: None (inferred from 100% identity to xcc:XCC1671)

MetaCyc: 56% identical to dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose transaminase (Aneurinibacillus thermoaerophilus L420-91)
RXN-12811 [EC: 2.6.1.90]

Predicted SEED Role

"Aminotransferase"

MetaCyc Pathways

• dTDP-3-acetamido-α-D-fucose biosynthesis (4/5 steps found)
• dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (4/6 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (8/19 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.90

Sequence Analysis Tools

See A0A0H2XA92 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Xcc-8004.3174.1 Aminotransferase (Xanthomonas campestris pv. campestris strain 8004)
MTLPEIPFLDLRAVNARYADALKAAAARVIDSGWYVLGQELAAFEEEFASYCGVQQAVGV
GNGLDALSLILRAYRELGVLREGDEVIVPANTFIATFLAISHNHLVLVPVEPDPQTFNVD
PCRVERAIGPRTRAILAVHLYGQLADMPALQTLAHRYGLLLIEDAAQAHGASRDGVRAGA
FGDAAAFSFFPTKNLGALGDGGAVVTSDPRLAERVRALRNYGSEVKYQHLFQGVNSRLDE
LQAAFLRVKLGYLDEEAAQRRAVAQRYLQEIDHPWITLPPVAHAEQHVWHLFVVRSQRRD
ALQSHLQHLGIQTQIHYPVPPHLQPAYAMLGDTCLPISEQLHREVLSLPMSPALDDAAVS
RVITACQVFGSVP