Protein Info for Xcc-8004.3165.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Glycosyltransferase (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 149 to 158 (10 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 24 to 174 (151 residues), 37.5 bits, see alignment E=3.8e-13 PF00534: Glycos_transf_1" amino acids 191 to 340 (150 residues), 95.3 bits, see alignment E=4.8e-31 PF13692: Glyco_trans_1_4" amino acids 191 to 329 (139 residues), 73.7 bits, see alignment E=2.9e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_2551)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8I5 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Xcc-8004.3165.1 Glycosyltransferase (EC 2.4.1.-) (Xanthomonas campestris pv. campestris strain 8004)
MKLAVVVPGGVDRSGEVRVIPVFLTLIDWLARNHEVHVFVLHQEPEPATWMLRGATVHNI
GQHRTRLRAIAAIREEHRRAPFDVVQALFSGYCSLIAVVAAKLLRRPSVVHIAGGELVAL
HGIGYGGRRRWRGRLREAVILRLADRVTAASLPIIASLHALGVTAQRVPLGVDLRAWPPA
PPRARSGGVARLLHVASLNPVKDQTTLLRALAALKRAGVAFVVDIVGVDTLDGRIHALAE
QLDLGAQVRFVGFKTQRELRPIMQSADLLLMSSLHEAGPMVLLEAALVGVPTVGTAVGHL
AEWAPSAALAVPPGDWAGLAEAIRQVLADDELRLRLAWAAQCRATREDAGLTTRLFETLY
RELCAERPLR