Protein Info for Xcc-8004.3137.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: tRNA pseudouridine 13 synthase (EC 4.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF01142: TruD" amino acids 19 to 168 (150 residues), 126.7 bits, see alignment E=5.6e-41 amino acids 197 to 349 (153 residues), 60 bits, see alignment E=9.8e-21

Best Hits

Swiss-Prot: 100% identical to TRUD_XANCP: tRNA pseudouridine synthase D (truD) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K06176, tRNA pseudouridine synthase D [EC: 5.4.99.12] (inferred from 100% identity to xcc:XCC1704)

Predicted SEED Role

"tRNA pseudouridine 13 synthase (EC 4.2.1.-)" in subsystem tRNA processing (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.4.99.12

Use Curated BLAST to search for 4.2.1.- or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UTP6 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Xcc-8004.3137.1 tRNA pseudouridine 13 synthase (EC 4.2.1.-) (Xanthomonas campestris pv. campestris strain 8004)
MSDSPVLPRAHGAAVLTAAMRSVAEDFQVDELPAFDASGEGEHLLLTVRKRGQNTAYVAK
RLAQWAGIAEMGIGYAGLKDRHAVTTQRFSVHLPKRIAPDLSALDDDDMQVVEHTWHNRK
LQRGALHGNRFVLTLREVVGDQAVIDARLHAIAARGIPNWFGEQRFGRDGGNVAAALAMF
GHTRQPDGTLAPAPKRRLRNDQRSLLLSAARSALFNQVLTARVEQGNWDAPLDGEAWMLD
GSRSVFGPEPWSEVLAERLARFDIHPSGPLWGAGELRCSADAAAIEQAALSDPQSLALRT
GLEAAGLKQERRALRLRPQGLAHAWLDAQTLQLTFALPPGCYATAVLWELGEVVDAARVA
PQSRSEG