Protein Info for Xcc-8004.3125.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Heat shock protein FtsJ/RrmJ @ Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF01728: FtsJ" amino acids 30 to 205 (176 residues), 185.9 bits, see alignment E=3.5e-59

Best Hits

Swiss-Prot: 100% identical to RLME_XANCP: Ribosomal RNA large subunit methyltransferase E (rlmE) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 100% identity to xcc:XCC1712)

MetaCyc: 54% identical to 23S rRNA 2'-O-ribose U2552 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11845 [EC: 2.1.1.166]

Predicted SEED Role

"Heat shock protein FtsJ/RrmJ @ Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.166

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UTQ4 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Xcc-8004.3125.1 Heat shock protein FtsJ/RrmJ @ Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-) (Xanthomonas campestris pv. campestris strain 8004)
MPSRSKSSQRWLKEHFADPFVKKAQAEGMRSRAAYKLEELLQRDRLLKPGMVVVDLGAAP
GGWSQQVRKSMGASGRVVALDILEMPPLAGVEFLHGDFREQAVLSEFEAMLGDVPVDLVL
SDMAPNKSGMDAVDQPRMMHLAELAMEFADTHLKVGGAFLIKLFQGVGSDDYIRELRRRY
EKVTIRKPAASRKRSAEVYVLGQGKRAQIK