Protein Info for Xcc-8004.3111.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: RecA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR02012: protein RecA" amino acids 4 to 326 (323 residues), 545.1 bits, see alignment E=2.8e-168 PF00154: RecA" amino acids 7 to 270 (264 residues), 461.8 bits, see alignment E=1.4e-142 PF08423: Rad51" amino acids 38 to 228 (191 residues), 29.4 bits, see alignment E=9.6e-11 PF21096: RecA_C" amino acids 273 to 328 (56 residues), 84.6 bits, see alignment E=8.1e-28

Best Hits

Swiss-Prot: 100% identical to RECA_XANCB: Protein RecA (recA) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to xca:xccb100_2537)

MetaCyc: 70% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UTR4 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Xcc-8004.3111.1 RecA protein (Xanthomonas campestris pv. campestris strain 8004)
MDENKKRALSAALSQIEKQFGKGSVMRMGDRVIEAVEVIPTGSLMLDIALGIGGLPKGRV
VEIYGPESSGKTTLTLQAIAECQKLGGTAAFIDAEHALDPIYAAKLGVNVDDLLLSQPDT
GEQALEIADMLVRSSSVDIVVIDSVAALTPKAEIEGEMGDQLPGLQARLMSQALRKLTGN
IKRSNTLVVFINQLRMKIGVMMPGQSPEVTTGGNALKFYASVRLDIRRIGAIKKGDEIIG
NQTKIKVVKNKLAPPFKQVITEILYGEGISREGELIDMGVEAKLVDKAGAWYSYGDERIG
QGKDNARGYLRDNPQVAIKLEAELREKFQPAEAPREAGETESE