Protein Info for Xcc-8004.3098.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Pirin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02678: Pirin
  • amino acids 8 to 119 (112 residues), 113.8 bits, E=5.9e-37
• PF17954: Pirin_C_2
  • amino acids 146 to 231 (86 residues), 98.1 bits, E=4e-32

Best Hits

Swiss-Prot: 50% identical to Y1773_SYNY3: Putative quercetin 2,3-dioxygenase sll1773 (sll1773) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K06911, (no description) (inferred from 100% identity to xca:xccb100_2530)

MetaCyc: 49% identical to quercetin 2,3-dioxygenase (Escherichia coli K-12 substr. MG1655)
Quercetin 2,3-dioxygenase. [EC: 1.13.11.24]

Predicted SEED Role

"Pirin"

MetaCyc Pathways

• rutin degradation (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.24

Sequence Analysis Tools

See A0A0H2X8I0 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Xcc-8004.3098.1 Pirin (Xanthomonas campestris pv. campestris strain 8004)
MLTVRKSETRGRAEHGWLSSRHTFSFASYHDPRHMGIGPLRVINEDKVKAGEGFGTHAHR
DMEIISYVLDGALEHKDSMGTSSVLHYGDVQRMSAGSGVTHSEFNHSASDPVHFLQIWVM
PERNGIEPSYEEKHFDADSKRNTLRLIASPNGDGGSLKLHQDARLYATILDGDGRLQHPL
AQGRLGYVQVARGSLTVNGQVLSAGDALQVTGEPEIVLADARDAEVLVFDLPQ