Protein Info for Xcc-8004.3091.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase" amino acids 14 to 259 (246 residues), 295.3 bits, see alignment E=1.6e-92 PF08543: Phos_pyr_kin" amino acids 21 to 260 (240 residues), 290.7 bits, see alignment E=8.5e-91 PF00294: PfkB" amino acids 112 to 243 (132 residues), 43.5 bits, see alignment E=2.8e-15

Best Hits

Swiss-Prot: 47% identical to THID_BACSU: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Bacillus subtilis (strain 168)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 100% identity to xcb:XC_2499)

MetaCyc: 47% identical to 4-amino-2-methyl-5-phosphomethylpyrimidine kinase (Bacillus subtilis subtilis 168)
Phosphomethylpyrimidine kinase. [EC: 2.7.4.7]; Hydroxymethylpyrimidine kinase. [EC: 2.7.4.7, 2.7.1.49]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XA49 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Xcc-8004.3091.1 hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
VQNRRMTTPSTLSALTIAGSDSGGGAGIQADLKTFAAHRVHGLSAITALTAQHTRGVTAV
HVPPLAFLRAQVDACFADFQIQAVKLGMLANAEVIHCVADLLEQYRPPFVVLDPVMVATS
GARLLEDAALDALRTRLLPLANLITPNTPEAELLTGRRIDTPDAADHATAALLELGANAV
LLKGGHLREGTRVIDRFDDGVAQEIFMHPRLELDTHGTGCTLSAAIAAQLCQGLSLLNAC
EAAIDYVARAIANGQRPGQSDVVVLDHFGAAPHAWD