Protein Info for Xcc-8004.3063.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: D-xylose proton-symporter XylE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 194 to 213 (20 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 381 to 406 (26 residues), see Phobius details amino acids 418 to 441 (24 residues), see Phobius details amino acids 447 to 469 (23 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 18 to 479 (462 residues), 373.3 bits, see alignment E=8.9e-116 PF00083: Sugar_tr" amino acids 30 to 480 (451 residues), 372 bits, see alignment E=7e-115 PF07690: MFS_1" amino acids 33 to 364 (332 residues), 118 bits, see alignment E=7.1e-38 PF06609: TRI12" amino acids 71 to 226 (156 residues), 32.1 bits, see alignment E=7.1e-12

Best Hits

Swiss-Prot: 52% identical to GLCP_SYNY3: Glucose transport protein (gtr) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K08139, MFS transporter, SP family, sugar:H+ symporter (inferred from 100% identity to xca:xccb100_2503)

Predicted SEED Role

"D-xylose proton-symporter XylE" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8G4 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Xcc-8004.3063.1 D-xylose proton-symporter XylE (Xanthomonas campestris pv. campestris strain 8004)
MFPGEPMSSVSIDGAPDAGENTRFIILISCVATIGGFLFGFDSGVINGTVDGLKQTFQSS
AAETGFEVASMLLGCAIGAFFAGRLVDRWGRRAVLIISAALFLLSAIGAGASHSSGFFIF
ARVMGGFAVGAASVISPAYIAEVASARYRGRLATMQQIAIISGLFCAFLSNYLLANAAGA
STEPLWGGQAAWRWMFWMQAIPSLLFLLLLLVIPESPRYLVVKGRREQALVVLKRLYGNA
AAQTKLGEISASMSADQHKPKFSDLISKTTGKIRPIVWIGVGLAVFQQLVGINVVFYYGA
VLWQAVGFSEQDALLINVLSGGLSIGACLVTVMLVDKIGRKPLLWIGSAGMAVSLALVTY
AFATASLDPNGKLAMSDAMGMLALVAANVYVVFFNASWGPVMWVMLGEMFPNQIRGSGLA
IAGAAQWTSNFAITVSFPILLGSIGLAGAYGIYTVAAFISVFFVLKYVYETKGKELEQME
G