Protein Info for Xcc-8004.3033.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase
  • amino acids 19 to 347 (329 residues), 215.4 bits, E=5e-68
• PF01565: FAD_binding_4
  • amino acids 38 to 159 (122 residues), 57.4 bits, E=1.4e-19
• PF02873: MurB_C
  • amino acids 222 to 346 (125 residues), 99.8 bits, E=8.9e-33

Best Hits

Swiss-Prot: 100% identical to MURB_XANC8: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to xcb:XC_2449)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (10/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (10/15 steps found)
• peptidoglycan recycling I (9/14 steps found)
• peptidoglycan biosynthesis II (staphylococci) (11/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (11/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (10/17 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

See Q4UTX4 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Xcc-8004.3033.1 UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158) (Xanthomonas campestris pv. campestris strain 8004)
MSAASPLRWQLIEHAPLRALNTFHVDATARWLLNIHAPEALPDALAAPQIAGQPLLVLGS
GSNVLLAGDPPGCVLCFDNRDITIIAHHADHAIVRAGAGVNWHGLVMYSLQQGLSGLENL
ALIPGTVGACPIQNIGAYGAQVSDFIHVVEAYDRGTEQFVRLNPAECAFGYRDSVFKQQP
DRYLIVAVEFNLPLLHELRLDYAGIRDELARMGAELAGAADVAQAVINIRQRKLPDPEVL
GNAGSFFKNPLLPSEQIAALQASFADMPVFPGEQPGQGKLSAAWLIEQCGWKGKREGDAG
ISEAHALVLVNHGSASGAQLLAFARQVAESVRERYSVILEPEPRVIGAHW