Protein Info for Xcc-8004.2984.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Type IV secretion system protein VirD4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details PF02534: T4SS-DNA_transf" amino acids 106 to 555 (450 residues), 371.5 bits, see alignment E=1.1e-114 PF10412: TrwB_AAD_bind" amino acids 186 to 518 (333 residues), 85.1 bits, see alignment E=7.4e-28 PF12696: TraG-D_C" amino acids 401 to 518 (118 residues), 96.8 bits, see alignment E=1.5e-31

Best Hits

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 100% identity to xcb:XC_2413)

Predicted SEED Role

"Type IV secretion system protein VirD4" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X895 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Xcc-8004.2984.1 Type IV secretion system protein VirD4 (Xanthomonas campestris pv. campestris strain 8004)
MTGKTKLSVATVLLLLALIAGVYLSGQLILMLLKVAGPLSFDTYWSYVKALDLPQFAPYS
PKIKLAGAIGFGVPLLAWFALLIPLFKPKAAALHGDARFASGSDLAKKDMLKPSPTGIVV
GKHGGKLVRLPGQQFVILAAPTRSGKGVGIVIPNLLDYQGSVVVLDIKQENFDLTSGWRK
SQGQEVFLFNPFAEDGRTHRWNPLSYISPDPAFRVSDLMSVAAMLYPDGSDAQKFWVSQA
RNAFMAFTLYLFDSLDDQIKRKHPKETWMFPTLGMLYRVSSGDGSDLKGYLKKLSQREFL
GRDAKTAFDNLLSQAEETFASIMGTFKEPLNQFINPILDASTSDNDFLLTDVRKKKMSIY
IGIQPNKLAESRLLINLLFSQLINLNTKELPQNNPALKHQCLLLMDEFTSIGRVDIIASA
VSYMAGYNIRLLPIIQSMAQLDATYGKDVSRTIITNHALQIVYAPREQQDANDYSDMLGY
TTVRKKNKSHTSGKQSSVSYSETEQRRALMLPQELKAMGFDKEVFLYEGIPSPVLCEKIK
YYEDAYFTKRLLPKVKIEALQMALA