Protein Info for Xcc-8004.2949.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: ATP phosphoribosyltransferase (EC 2.4.2.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR00070: ATP phosphoribosyltransferase" amino acids 13 to 201 (189 residues), 180.1 bits, see alignment E=4e-57 PF01634: HisG" amino acids 60 to 223 (164 residues), 154.6 bits, see alignment E=2.1e-49 TIGR03455: ATP phosphoribosyltransferase, C-terminal domain" amino acids 206 to 302 (97 residues), 61.8 bits, see alignment E=5.8e-21 PF08029: HisG_C" amino acids 231 to 300 (70 residues), 26.9 bits, see alignment E=4.4e-10

Best Hits

Swiss-Prot: 100% identical to HIS1_XANC8: ATP phosphoribosyltransferase (hisG) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00765, ATP phosphoribosyltransferase [EC: 2.4.2.17] (inferred from 100% identity to xcc:XCC1808)

Predicted SEED Role

"ATP phosphoribosyltransferase (EC 2.4.2.17)" in subsystem Histidine Biosynthesis (EC 2.4.2.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UU39 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Xcc-8004.2949.1 ATP phosphoribosyltransferase (EC 2.4.2.17) (Xanthomonas campestris pv. campestris strain 8004)
MSASTAAPARDRLRIAIQKNGRLAEPARSLLAACGLSWRQSRDKLFCYGESLPVDLLLVR
DDDIPGLIADGVCDLGIVGQNELDEQASARRRAGLPAAYHAVRGVGFGQCRLMLAVPEEW
DWQGVAQLAGKRIATSYPAILADWLERQGIDASVVELSGSVEIAPRLGTADLICDLVSSG
ATLAANQLKPVELVMESEAVLAGAVREPADARAALLAMLLRRMDGVLKLRDSKLLMFRAE
QGNVDALRRLLPDADPLVQLPDDGNGALRLQTMCHGAVTWQRLEELERAGAQGLMVLTVE
RSLA