Protein Info for Xcc-8004.2896.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 31 to 423 (393 residues), 334.3 bits, E=8.9e-104
• PF13193: AMP-binding_C
  • amino acids 474 to 548 (75 residues), 68.4 bits, E=8.2e-23

Best Hits

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 100% identity to xcb:XC_2331)

MetaCyc: 55% identical to medium-chain-fatty-acid--CoA ligase (Pseudomonas aeruginosa PAO1)
Butyrate--CoA ligase. [EC: 6.2.1.2, 6.2.1.3]

Predicted SEED Role

"Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)" in subsystem Biotin biosynthesis or n-Phenylalkanoic acid degradation (EC 6.2.1.3)

MetaCyc Pathways

• oleate β-oxidation (31/35 steps found)
• fatty acid salvage (5/6 steps found)
• γ-linolenate biosynthesis II (animals) (2/2 steps found)
• long-chain fatty acid activation (1/1 steps found)
• palmitate biosynthesis III (21/29 steps found)
• phosphatidylcholine acyl editing (3/4 steps found)
• phytol degradation (3/4 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (38/53 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (22/31 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• linoleate biosynthesis II (animals) (1/2 steps found)
• octane oxidation (3/5 steps found)
• superpathway of fatty acid biosynthesis II (plant) (30/43 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• alkane biosynthesis II (1/3 steps found)
• oleate biosynthesis I (plants) (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• valproate β-oxidation (5/9 steps found)
• long chain fatty acid ester synthesis (engineered) (1/4 steps found)
• wax esters biosynthesis II (1/4 steps found)
• capsaicin biosynthesis (3/7 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• 2-deoxy-D-ribose degradation II (3/8 steps found)
• arachidonate biosynthesis III (6-desaturase, mammals) (2/7 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• icosapentaenoate biosynthesis II (6-desaturase, mammals) (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• icosapentaenoate biosynthesis III (8-desaturase, mammals) (1/7 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• sporopollenin precursors biosynthesis (4/18 steps found)
• cutin biosynthesis (1/16 steps found)
• suberin monomers biosynthesis (2/20 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Fatty acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.2 or 6.2.1.3

Sequence Analysis Tools

See A0A0H2X9L8 at UniProt or InterPro

Protein Sequence (560 amino acids)

>Xcc-8004.2896.1 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3) (Xanthomonas campestris pv. campestris strain 8004)
MSQARPWLQSYPAGVAAEIDLEQFSTVAEVFATSVARFADRPAYHSFGKTITYREADQLV
DQFAAYLLGELQLKKGDRVALMMPNCLQYPIATFGILRAGLTVVNVNPLYTPRELKHQLI
DSGSSVLVVIDNFGTTVQQVIADTQVKQVITTGLGDMLGFPKAALVNFVVKYVKKLVPEY
RINGAIRFRDALALGRKHRVPTLQIEPDDIAFLQYTGGTTGVAKGAMLTHRNLVANMQQA
HQWLAGTGKLEEGHEVVITALPLYHIFALTANGLVFMKIGGCNHLISNPRDMPGFVKELK
KTRFTAFTGVNTLFNGLLNTPGFDQIDFSSLKMTLGGGMAVQRSVAERWKQVTGLTLVEA
YGLTETSPAACINPMDLVDYNGSIGLPIPSTDACIKDDDGKVLALGEIGELCIKGPQVMK
GYWKKADETAKVMDAEGWLHTGDIARMDERGFVYIVDRKKDMILVSGFNVYPNEIEDVIA
TMPGVLEVAAVGVPDEKSGEIVKVVIVKKDQALTAEDVKAHCRTNLTGYKQPRVIEFRKE
LPKTNVGKILRRELRDAAKA