Protein Info for Xcc-8004.2874.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 793 transmembrane" amino acids 55 to 77 (23 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 50 to 226 (177 residues), 65.4 bits, see alignment E=1.3e-21 PF00672: HAMP" amino acids 253 to 303 (51 residues), 34.8 bits, see alignment 4.4e-12 PF18575: HAMP_N3" amino acids 351 to 393 (43 residues), 65.1 bits, see alignment 8.3e-22 PF18947: HAMP_2" amino acids 419 to 480 (62 residues), 36.5 bits, see alignment 9.7e-13 PF00015: MCPsignal" amino acids 549 to 703 (155 residues), 180.5 bits, see alignment E=6.6e-57

Best Hits

KEGG orthology group: None (inferred from 100% identity to xca:xccb100_2163)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9K2 at UniProt or InterPro

Protein Sequence (793 amino acids)

>Xcc-8004.2874.1 Methyl-accepting chemotaxis protein I (serine chemoreceptor protein) (Xanthomonas campestris pv. campestris strain 8004)
MTCTPHAPAPAATSAQLRTAAPSLRVPGQGATVLPCHLRPEMTAFLQRYNVGTRLSFAFG
ILILLSCALVAAGLYTLAQARERLDTVVNRNITIMQHLQDMTDDTSVIAVQLRNLVLPTS
QEDNLRFAALIKDRAKAYEQTRQTLYVFSASPEAQARRDKIDAASAAAAKANAQVAELGL
ASKSDEALAMLMQQAAPATEAWQSALAEYSALQRKRAKTAYEDATAAMARGRAMLIGGGI
AVLLFSGLLGWMITRSLVRPLSQATLAAEAIANGSLDNDVRSTANDETGRLLHAMDRMQS
QVRNLITAQLNMAKRHEEGQISFRMDAAAFPGDFGRMASDTNELVASHIKVKMQTIHLVE
RYAIGDLSEDMPRLPGEKAAITAAMDQVKTNLSTMNQQIKHLAQAAASGDFTARGDADKF
QFDFRLMVQSLNTLMSTADGNLQSLSSLLQSIAAGDLTARMTGQYQGVFAQMRDDANATA
EQLASIVGRIQHAADAIGLASSEIASGNQDLSQRTEQQAANLEETAASMEELTSTVKQNA
EHASQANQLAIGAAAVASQGGEVVAKVVTTMADIQGSSKKIAEIISVIDGIAFQTNILAL
NAAVEAARAGEQGRGFAVVASEVRTLAQRSAGAAKEIKHLIDDSVSKVTQGAALVDQAGT
TMADIVASVQRVTNIMGEISSASQEQYSGIEQVNQTVTQMDETTQQNAALVEEATAAARA
MEEQAQQLTETVAVFKLAAQAPVARQLSAIASAPGNARSAARPAARTTVAAAAPRPVRTA
PATTADQSDWQEF