Protein Info for Xcc-8004.2835.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Signal transduction histidine kinase CheA (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 PF01627: Hpt" amino acids 8 to 104 (97 residues), 57.2 bits, see alignment E=3.2e-19 PF02895: H-kinase_dim" amino acids 170 to 229 (60 residues), 50 bits, see alignment 6.8e-17 PF02518: HATPase_c" amino acids 278 to 417 (140 residues), 71.2 bits, see alignment E=1.9e-23 PF01584: CheW" amino acids 424 to 547 (124 residues), 91.8 bits, see alignment E=6e-30

Best Hits

KEGG orthology group: K03407, two-component system, chemotaxis family, sensor kinase CheA [EC: 2.7.13.3] (inferred from 100% identity to xca:xccb100_2198)

Predicted SEED Role

"Signal transduction histidine kinase CheA (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7M2 at UniProt or InterPro

Protein Sequence (551 amino acids)

>Xcc-8004.2835.1 Signal transduction histidine kinase CheA (EC 2.7.3.-) (Xanthomonas campestris pv. campestris strain 8004)
MSAVPDDIAADFIVEAQEILDRLGEQLVSLEQAPDEADQLNAVFRGFHTLKGGAGFLAIK
PMVELCHAAEETLGMARSGQAVLQAHHFDAAQQSLDYLQAMLDAMGSGDPVPHAPASLIA
QFDAKSGPPAVKSAPKAAALAAVPAGQAPAAAGAKATPKAAAKSGGAEAEQTVRVDTKRL
DAIVNLIGELVLSRNRLKTLRTRLRDEELDRAVSTLDIATARLQTAVMRTRMQPVSKVFS
RFPKVARDVARTLSKEVELELIGAETELDRNLVEALADPLVHLVRNAIDHGIESPALREA
TGKPRSGHVRLSAQQEGDYVSIEIQDDGAGIDPERLREIARNKGLIDAEAAARLSTDECL
HLIFMPGFSTKAEVTDISGRGVGMDVVQSRIRELSGQIQIQSELGRGSRFMIRVPLTLAI
LPTLLVQAGEAVYALPLARVVEVLHAPQSSLGWFDGRAVLDRRSHTLPLIDLRRWLGVPA
EQPPLLTVVLLQAGETRFGLVVDQVRGREEVVIKPLPRALRGLPGYAGATLIGDGRMALI
LDVDGLRSSDH