Protein Info for Xcc-8004.2831.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Flagellar synthesis regulator FleN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF13614: AAA_31" amino acids 27 to 182 (156 residues), 52.7 bits, see alignment E=2.1e-17 PF10609: ParA" amino acids 27 to 77 (51 residues), 41.3 bits, see alignment 5.1e-14 amino acids 135 to 266 (132 residues), 36.2 bits, see alignment E=1.9e-12 PF09140: MipZ" amino acids 28 to 206 (179 residues), 24.6 bits, see alignment E=5.9e-09 PF06564: CBP_BcsQ" amino acids 28 to 63 (36 residues), 21.8 bits, see alignment 5e-08 PF00142: Fer4_NifH" amino acids 29 to 277 (249 residues), 44.7 bits, see alignment E=4.8e-15 PF01656: CbiA" amino acids 29 to 247 (219 residues), 72.5 bits, see alignment E=1.3e-23 PF02374: ArsA_ATPase" amino acids 30 to 64 (35 residues), 33.7 bits, see alignment 9.5e-12

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 100% identity to xcv:XCV1978)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7Y1 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Xcc-8004.2831.1 Flagellar synthesis regulator FleN (Xanthomonas campestris pv. campestris strain 8004)
MQSREYAKLTNAFPLSATRPEPLGPVRTIAVTGGKGGVGKTNISANLAVALADMGKRTLL
LDADLGLANLDVVLGLSPKYTLADLIAGRCTLDEVIIEGPGGVLVVPAASGRRHMAELAP
AQHIGLVNVFSELERDLDVMVIDTAAGITDSVLTFCQAAQDTVVVVCDEPASITDAYALI
KVLSRERGVDRLQIIANMVRDPNEGRLLYDKLSRVCEKFLGDVSLNYLGHVPQDDWLRLS
VQRQQPVIKAYPASPSAQAIAEIARRTSRWQAPTVPRGNVEFFVERIIQRGVAA