Protein Info for Xcc-8004.2823.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Flagellar biosynthesis protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 80 to 105 (26 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 20 to 260 (241 residues), 192.7 bits, see alignment E=4.1e-61 PF01311: Bac_export_1" amino acids 20 to 253 (234 residues), 191.9 bits, see alignment E=6.8e-61

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to xca:xccb100_2210)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9G3 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Xcc-8004.2823.1 Flagellar biosynthesis protein FliR (Xanthomonas campestris pv. campestris strain 8004)
MDAATQMVIDGQRAFAMVGAIMWTMLRTGALLTAMPLIGTRAVPGRVRVMLTGTLAMALA
PILPPVPEWDGFNATAVLSIARELAVGASMGFMLRLIFEAGALAGELVSQATGLSFAQMS
DPLRGVTSGVIAQWFYIGFGLLFFAANGHLAVIALLVDSYKALPIGTAVPDAAAFAEVAP
TLLLQVLRGGLTLALPMMVAMLAVNLAFGALAKAAPALNPMQLGLPLTVLLGLFLLSSFA
SEFAPPVQRLFDSAFDAARALTG