Protein Info for Xcc-8004.2819.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Flagellar biosynthesis protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 79 to 108 (30 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 219 to 245 (27 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details PF00813: FliP" amino acids 81 to 273 (193 residues), 248.3 bits, see alignment E=2.9e-78 TIGR01103: flagellar biosynthetic protein FliP" amino acids 81 to 277 (197 residues), 254.4 bits, see alignment E=3.7e-80

Best Hits

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 99% identity to xca:xccb100_2213)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9K5 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Xcc-8004.2819.1 Flagellar biosynthesis protein FliP (Xanthomonas campestris pv. campestris strain 8004)
MFSRWNRWGRSVRLVLILLVMSCPLLASATPAALPAMAQAAAPAAAPAAPATGNQIPTLP
NVSVGRIGDQPVSLPLQTLLLMTAITLLPSMLLVLTAFTRITIVLGLLRQALGTGQTPSN
QVLLGLAMFLTALVMMPVWQKMWGAGLQPYLNNQIDFSTAWTLTTQPLRAFMLAQIRETD
LMTFAGMAGDGKYAGPDAVPFPVLVASFVTSELKTAFEIGFLIFIPFVIIDLVVASVLMS
MGMMMLSPMLISAPFKILLFILVDGWVLVVGTLAASFNAS