Protein Info for Xcc-8004.2800.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Flagellar regulatory protein FleQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF06490: FleQ" amino acids 5 to 120 (116 residues), 72.2 bits, see alignment E=1.1e-23 PF14532: Sigma54_activ_2" amino acids 140 to 309 (170 residues), 81.2 bits, see alignment E=2.2e-26 PF00158: Sigma54_activat" amino acids 140 to 305 (166 residues), 245.1 bits, see alignment E=7.6e-77 PF07728: AAA_5" amino acids 162 to 281 (120 residues), 28.9 bits, see alignment E=2.7e-10 PF02954: HTH_8" amino acids 446 to 485 (40 residues), 47.7 bits, see alignment 2.6e-16

Best Hits

KEGG orthology group: K10941, sigma-54 specific transcriptional regulator, flagellar regulatory protein A (inferred from 100% identity to xca:xccb100_2230)

Predicted SEED Role

"Flagellar regulatory protein FleQ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7J2 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Xcc-8004.2800.1 Flagellar regulatory protein FleQ (Xanthomonas campestris pv. campestris strain 8004)
MSESRILLIDSDAVRAERTVSLLEFMDFNPRWVTDGADINPGRHRHDEWMAVMVGSAQDA
AQADKFFDWLADAKLPPPVLLMEGSPSAFAQAHGLHEANVWALDTPLRHAQLEALLRRAS
LKRLDAEHQAGVQQDTGPTGNSEAVTRLRRLIDQVAAFDTTVLVLGESGTGKEVVARAIH
QHSPRRDGPFVAINCGAIPPDLLESELFGHEKGAFTGALTTRKGRFEMAEGGTLLLDEIG
DMSLPMQVKLLRVLQERSFERVGGGQTIRCNVRVIAATHRNLETRISDGQFREDLFYRLN
VFPIEMPALRERVDDLAILVQTIAGQLARTGRGEVRFADEALQALRSYDWPGNVRELTNL
VERLAVLHPGGLVRVQDLPARYRGDFASSIPVELPPEPALVAPHGEVAALPSNVVTLQPA
TAHADAEPLTASSLPDDGIDLRGHMANIELALINEALERTQGVVAHAAQLLGLRRTTLVE
KLRKYGIDREQTELAN